PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG261700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 232aa    MW: 25251.7 Da    PI: 9.8022
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG261700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.4e-1880133356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k+ +++keq + Lee F+ n++++ +++e LA kl+L  rqV vWFqNrRa+ k
  Pavir.5NG261700.1.p  80 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRARTK 133
                          67789***********************************************98 PP

2HD-ZIP_I/II119.51.8e-3880167289
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                          kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E ++e+Lkr++ +l+een+rL++eveeLr+
  Pavir.5NG261700.1.p  80 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAVKLKLRPRQVEVWFQNRRARTKLKQTELECEYLKRCFGSLTEENRRLQREVEELRA 167
                          9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-1855136IPR009057Homeodomain-like
SuperFamilySSF466894.28E-1970136IPR009057Homeodomain-like
PROSITE profilePS5007116.90875135IPR001356Homeobox domain
SMARTSM003893.3E-1577139IPR001356Homeobox domain
CDDcd000869.77E-1578136No hitNo description
PfamPF000469.3E-1680133IPR001356Homeobox domain
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
SMARTSM003406.3E-22135178IPR003106Leucine zipper, homeobox-associated
PfamPF021837.7E-10135168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGSTSPSGLE LTMAVPGLSS SSGSEGGFGC NAGSGSGNAM RDLDMNQPAS GGEEEEFPMG  60
SVEEDEEERG AGAGGPHRPK KLRLSKEQSR LLEESFRLNH TLTPKQKEAL AVKLKLRPRQ  120
VEVWFQNRRA RTKLKQTELE CEYLKRCFGS LTEENRRLQR EVEELRAMRM APPTVLSPHT  180
RQPLPASALT MCPRCERITA ATTTTGAPAA RTPRPAAAAA SPFHRGVLIR R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.24047e-50stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0626880.0BT062688.2 Zea mays full-length cDNA clone ZM_BFb0333H18 mRNA, complete cds.
GenBankEU9661900.0EU966190.1 Zea mays clone 292384 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969293.11e-125PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ9XH381e-124HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-124HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
TrEMBLK3XLQ01e-124K3XLQ0_SETIT; Uncharacterized protein
STRINGSi002823m1e-124(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.18e-57homeobox-leucine zipper protein 17